| IP Address: | 23.155.76.9 |
| ISP: | Keshia Services Inc. |
| Connection Speed: | (DSL) Broadband/Cable/Fiber |
| City: | Kalamazoo |
| Country: | United States of America |
| State: | Michigan |
| Latitude: | 42.29171 |
| Longitude: | -85.587227 |
| Time Zone: | UTC -04:00 |
| Local Time: | 17 Sep, 2026 10:22 AM |
| Proxy: | No |
| Proxy Provider: | - |
| Fraud Score: | 0 |
| Address Type: | Unicast |
| District: | Kalamazoo County |
| ZIP Code: | 49001 |
| Area Code: | 269 |
| IDD Code: | 1 |
| Weather Station: | Kalamazoo (USMI0442) |
| Usage Type: | (COM) Commercial |
| Domain Name: | keshiaservicesfinancialsystems.net [WHOIS keshiaservicesfinancialsystems.net] |
| Mobile MNC: | - |
| Mobile MCC: | - |
| Mobile Brand: | - |
| Elevation: | 239 meters |
| Atmospheric Pressure: | 985 hPa |
| ASN Number: | 401880 |
| ASN Name: | Keshia Services Inc. |
| Category: | - |
| Hosted Domain: | - |
| User Agent: | Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; [email protected]) |
| Referrer: | |
| Device: | unknown |
| Operating System: | unknown |
| Architecture: | 32 bits |
| Browser: | DefaultProperties |
| Country: | United States of America |
| Capital: | Washington |
| Continent: | North America |
| Population: | 310,232,863 |
| Area: | 9,629,091 km² |
| Currency: | (USD) Dollar |
| Top Level Domain: | .us |
Is the above data incorrect? Help us improve our database accuracy. wrong data.
The IP geolocation information on ipaddress.my is sourced from the IP2Location.io IP Geolocation API . Sign up for free API access now.
$ curl "https://api.ip2location.io/?key={YOUR_API_KEY}&ip=23.155.76.9"
{
"ip": "23.155.76.9",
"country_code": "US",
"country_name": "United States of America",
"region_name": "Michigan",
"district": "Kalamazoo County",
"city_name": "Kalamazoo",
"latitude": 42.29171,
"longitude": -85.58723,
"zip_code": "49001",
"time_zone": "-04:00",
"asn": "401880",
"as": "Keshia Services Inc.",
"as_info": {
"as_number": "401880",
"as_name": "Keshia Services Inc.",
"as_domain": "-",
"as_usage_type": "-",
"as_cidr": "23.155.76.0/24"
},
"isp": "Keshia Services Inc.",
"domain": "keshiaservicesfinancialsystems.net",
"net_speed": "DSL",
"idd_code": "1",
"area_code": "269",
"weather_station_code": "USMI0442",
"weather_station_name": "Kalamazoo",
"mcc": "-",
"mnc": "-",
"mobile_brand": "-",
"elevation": 239,
"usage_type": "COM",
"address_type": "Unicast",
"ads_category": "-",
"ads_category_name": null,
"continent": {
"name": "North America",
"code": "NA",
"hemisphere": [
"north",
"west"
],
"translation": {
"lang": null,
"value": null
}
},
"country": {
"name": "United States of America",
"alpha3_code": "USA",
"numeric_code": 840,
"demonym": "Americans",
"flag": "https://cdn.ip2location.io/assets/img/flags/us.png",
"capital": "Washington, D.C.",
"total_area": 9826675,
"population": 339665118,
"currency": {
"code": "USD",
"name": "United States Dollar",
"symbol": "$"
},
"language": {
"code": "EN",
"name": "English"
},
"tld": "us",
"translation": {
"lang": null,
"value": null
}
},
"region": {
"name": "Michigan",
"code": "US-MI",
"translation": {
"lang": null,
"value": null
}
},
"city": {
"name": "Kalamazoo",
"translation": {
"lang": null,
"value": null
}
},
"time_zone_info": {
"olson": "America/Detroit",
"current_time": "2026-09-17T10:22:39-04:00",
"gmt_offset": -14400,
"is_dst": true,
"abbreviation": "EST",
"dst_start_date": "2026-03-08",
"dst_end_date": "2026-11-01",
"sunrise": "07:25",
"sunset": "19:50"
},
"geotargeting": {
"metro": "563"
},
"is_proxy": false,
"fraud_score": 0,
"proxy": {
"last_seen": 0,
"proxy_type": "-",
"threat": "-",
"provider": "-",
"is_vpn": false,
"is_tor": false,
"is_data_center": false,
"is_public_proxy": false,
"is_web_proxy": false,
"is_web_crawler": false,
"is_ai_crawler": false,
"is_residential_proxy": false,
"is_consumer_privacy_network": false,
"is_enterprise_private_network": false,
"is_spammer": false,
"is_scanner": false,
"is_botnet": false,
"is_bogon": false
}
}
Get detailed location info from IP addresses using downloadable databases.
Instantly retrieve IP geolocation data with a fast and reliable API.
Access domain owner and registrar info in real-time via API.
Download a free IP geolocation database with essential location data.
Retrieve comprehensive IP geolocation information by IP address lookup.
Get Free Demo Account Today